IGF-LR3
$89.00
IGF-LR3 (Long R3 IGF-1) is an 83 amino acid analogue of insulin-like growth factor 1, used in cell culture and IGF-1 receptor research. Supplied as 1 mg of lyophilized powder in a sealed 3 mL vial, with a lot-matched Certificate of Analysis.
- Research use only Not for human or veterinary use
- Certificate per lot Published against the lot number
- Independently tested RP-HPLC with LC-MS identity
- Restricted sale 21+ qualified researchers only
Overview
IGF-LR3 is an analogue of human IGF-1 with an arginine substitution at position 3 and a 13 amino acid N-terminal extension, giving 83 amino acids in total.
Research context
These changes reduce binding to IGF binding proteins. IGF-LR3 is used in cell culture research and in studies of IGF-1 receptor signalling through the PI3K/AKT and MAPK pathways.
Specifications
- Form: Lyophilized powder
- Quantity: 1 mg
- Container: 3 mL glass vial, sealed
- Storage: Minus 20 °C, dry and protected from light
- Documentation: Lot-specific Certificate of Analysis (identity and purity by HPLC-MS), matched to the batch number on the label
For laboratory research use only. Not a drug, food, cosmetic or medical device. Not for human or animal use of any kind. No usage guidance is provided.
| Color Palette | Olive/Forest |
|---|---|
| Vial size | 1 mg |
Identity and chemistry
| Compound | IGF-LR3 (Long R3 IGF-1) |
|---|---|
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| CAS number | 946870-92-4 |
| Molecular formula | C400H625N111O115S9 |
| Molecular weight | 9117.6 g/mol |
| Quantity per vial | 1 mg |
| Form | Lyophilized powder |
| Appearance | White to off-white powder |
| Purity specification | Lot-specific. The measured purity for each lot is reported on its Certificate of Analysis |
| Test methods | RP-HPLC for purity, mass spectrometry (LC-MS) for identity |
| Solubility for analytical use | Select the solvent according to your laboratory’s validated analytical method |
Molecular weights are average masses for the free peptide. The salt form and counter-ion content can vary between lots, so the Certificate of Analysis for your lot is the reference for identity and purity results.
What arrives with the order
- One sealed 3 mL glass vial per unit ordered, containing 1 mg of lyophilized powder
- A label showing the compound name, quantity and lot number
- A lot-specific Certificate of Analysis, available on this page and in the COA library
Identity and chemistry information for laboratory research use only.
On arrival
- Inspect: Check that the seal is intact and that the lot number on the label matches the Certificate of Analysis.
- Store: Move the sealed vial to minus 20 °C as soon as it is received.
- Protect: Keep the vial dry and away from direct light.
Lyophilized storage
IGF-LR3 is supplied as 1 mg of lyophilized powder in a sealed 3 mL glass vial. Lyophilized peptide material tolerates short periods at ambient temperature in transit. For storage beyond that, keep the vial sealed at minus 20 °C, dry and protected from light.
Before opening
Let the sealed vial reach room temperature before opening, ideally in a desiccator, so that moisture does not condense on the powder. Open and handle the vial under clean laboratory conditions.
Stock solutions
Prepare stock solutions, expressed in mg/mL, according to your laboratory’s validated method and the solubility of the compound. Divide the solution into single-use aliquots and store them frozen, avoiding repeated freeze-thaw cycles. Label each aliquot with the lot number and the date of preparation.
Disposal
Dispose of unused material and contaminated consumables as laboratory chemical waste, in line with applicable federal, state and local rules.
Laboratory storage and handling information only. No usage guidance is given or implied.
What purity specification does this lot meet?
Every lot of IGF-LR3 is tested for identity and purity by HPLC-MS before release. The measured purity for your lot is shown on its Certificate of Analysis, matched to the lot number printed on the vial label.
Where do I find the Certificate of Analysis for my vial?
Lot testing records appear on this product page. You can also search by compound name or lot number in the COA library.
What arrives with the order?
One sealed 3 mL glass vial per unit ordered, containing 1 mg of lyophilized IGF-LR3. Each vial is labeled with the compound name, quantity and lot number, so it can be matched to its Certificate of Analysis.
How should the vial be stored when it arrives?
Move the sealed vial to minus 20 °C, dry and protected from light, as soon as it is received. The Storage and handling tab covers storage, opening, stock solutions and disposal.
Is IGF-LR3 for human or veterinary use?
No. IGF-LR3 is supplied strictly for in vitro laboratory research. It is not a drug, dietary supplement, food or cosmetic, has not been approved by the U.S. Food and Drug Administration, and must not be used in humans or animals. Sale is restricted to persons aged 21 or over who are qualified researchers or who buy on behalf of a research institution, laboratory or business.
Looking for something else?
Tell us the compound and quantity you are looking for and we will confirm availability and lead time. For research use only.
Contact Us
